SCOPe 2.03: Domain d3sk3b1: 3sk3 B:2-199

Lineage for d3sk3b1 (3sk3 B:2-199)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)

8. Domain d3sk3b1: 3sk3 B:2-199 [216427]
   automated match to d1g99a1
   complexed with cit, edo

Details for d3sk3b1

PDB Entry: 3sk3, 1.9 Å

PDB Description: Crystal structure of Salmonella typhimurium acetate kinase (AckA) with citrate bound at the dimeric interface

PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d3sk3b1:

Sequence; same for both SEQRES and ATOM records:

>d3sk3b1 c.55.1.0 (B:2-199) automated matches {Salmonella enterica [TaxId: 90371]}
ssklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgaga
ahsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfap
lhnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrryga
hgtshfyvtqeaakmlnk

Timeline for d3sk3b1:

• d3sk3b1 is new in SCOPe 2.03-stable
  
• d3sk3b1 appears in SCOPe 2.04
  
• d3sk3b1 appears in the current release, SCOPe 2.08