SCOPe 2.08: Domain d3seye1: 3sey E:1-359

Lineage for d3seye1 (3sey E:1-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d3seye1: 3sey E:1-359 [216376]
   Other proteins in same PDB: d3seya2, d3seyc2, d3seye2
   automated match to d1a7lc_
   complexed with act, gol, zn
   has additional insertions and/or extensions that are not grouped together

Details for d3seye1

PDB Entry: 3sey, 1.85 Å

PDB Description: zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)

PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3seye1:

Sequence; same for both SEQRES and ATOM records:

>d3seye1 c.94.1.1 (E:1-359) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
dvgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtsk
vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd

Timeline for d3seye1:

• d3seye1 first appeared in SCOPe 2.03, called d3seye_
  
• d3seye1 appears in SCOPe 2.07