| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
| Species Escherichia coli [TaxId:562] [53863] (69 PDB entries) Uniprot P02928 |
| Domain d3seye1: 3sey E:1-359 [216376] Other proteins in same PDB: d3seya2, d3seyc2, d3seye2 automated match to d1a7lc_ complexed with act, gol, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3sey (more details), 1.85 Å
SCOPe Domain Sequences for d3seye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3seye1 c.94.1.1 (E:1-359) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
dvgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtsk
vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
Timeline for d3seye1:
View in 3DDomains from other chains: (mouse over for more information) d3seya1, d3seya2, d3seyc1, d3seyc2 |