SCOPe 2.08: Domain d3sexc1: 3sex C:2-359

Lineage for d3sexc1 (3sex C:2-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d3sexc1: 3sex C:2-359 [216373]
   Other proteins in same PDB: d3sexa2, d3sexc2
   automated match to d1a7lc_
   complexed with iod, ni
   has additional insertions and/or extensions that are not grouped together

Details for d3sexc1

PDB Entry: 3sex, 1.95 Å

PDB Description: ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)

PDB Compounds: (C:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3sexc1:

Sequence; same for both SEQRES and ATOM records:

>d3sexc1 c.94.1.1 (C:2-359) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd

Timeline for d3sexc1:

• d3sexc1 first appeared in SCOPe 2.03, called d3sexc_
  
• d3sexc1 appears in SCOPe 2.07