SCOPe 2.08: Domain d3seua1: 3seu A:5-359

Lineage for d3seua1 (3seu A:5-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d3seua1: 3seu A:5-359 [216370]
   Other proteins in same PDB: d3seua2
   automated match to d1a7lc_
   complexed with act, gol, zn
   has additional insertions and/or extensions that are not grouped together

Details for d3seua1

PDB Entry: 3seu, 1.85 Å

PDB Description: zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form iii)

PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3seua1:

Sequence; same for both SEQRES and ATOM records:

>d3seua1 c.94.1.1 (A:5-359) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd

Timeline for d3seua1:

• d3seua1 first appeared in SCOPe 2.03, called d3seua_
  
• d3seua1 appears in SCOPe 2.07