Lineage for d3sbrb2 (3sbr B:508-638)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528843Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1528844Protein automated matches [190824] (20 species)
    not a true protein
  7. 1529045Species Pseudomonas stutzeri [TaxId:316] [226186] (3 PDB entries)
  8. 1529057Domain d3sbrb2: 3sbr B:508-638 [216301]
    Other proteins in same PDB: d3sbra1, d3sbrb1, d3sbrc1, d3sbrd1, d3sbre1, d3sbrf1, d3sbrg1, d3sbrh1
    automated match to d1qnia1
    complexed with ca, cl, cua, cuk, imd, k, n2o

Details for d3sbrb2

PDB Entry: 3sbr (more details), 2.24 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbrb2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d3sbrb2:

Click to download the PDB-style file with coordinates for d3sbrb2.
(The format of our PDB-style files is described here.)

Timeline for d3sbrb2: