Lineage for d3sbrd1 (3sbr D:51-507)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554792Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 1554793Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins)
  6. 1554807Protein automated matches [226900] (2 species)
    not a true protein
  7. 1554813Species Pseudomonas stutzeri [TaxId:316] [226185] (3 PDB entries)
  8. 1554827Domain d3sbrd1: 3sbr D:51-507 [216304]
    Other proteins in same PDB: d3sbra2, d3sbrb2, d3sbrc2, d3sbrd2, d3sbre2, d3sbrf2, d3sbrg2, d3sbrh2
    automated match to d1qnia2
    complexed with ca, cl, cua, cuk, imd, k, n2o

Details for d3sbrd1

PDB Entry: 3sbr (more details), 2.24 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate
PDB Compounds: (D:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbrd1 b.69.3.1 (D:51-507) automated matches {Pseudomonas stutzeri [TaxId: 316]}
qavkeskqkihvgpgelddyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwglt
nesrhimgdsakflngdchhphismtdgkydgkylfindkansrvarirldimkcdkmit
vpnvqaihglrlqkvphtkyvfanaefiiphpndgkvfdlqdensytmynaidaetmema
fqvivdgnldntdadytgrfaaatcynsekafdlggmmrnerdwvvvfdihaveaavkag
dfitlgdsktpvldgrkkdgkdskftryvpvpknphgcntssdgkyfiaagklsptcsmi
aidklpdlfagkladprdvivgepelglgplhttfdgrgnayttlfidsqvvkwnmeeav
raykgekvnyikqkldvhyqpghlhaslcetneadgkwlvalskfskdrflpvgplhpen
dqlidisgdemklvhdgptfaephdcimarrdqiktk

SCOPe Domain Coordinates for d3sbrd1:

Click to download the PDB-style file with coordinates for d3sbrd1.
(The format of our PDB-style files is described here.)

Timeline for d3sbrd1: