Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Bacteriophytochrome BphP [160661] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries) Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325 |
Domain d3s7oa2: 3s7o A:135-323 [216231] Other proteins in same PDB: d3s7oa1 automated match to d1ztua1 complexed with gol, lbv |
PDB Entry: 3s7o (more details), 1.24 Å
SCOPe Domain Sequences for d3s7oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s7oa2 d.110.2.1 (A:135-323) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg lhaflghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl qvqvkeale
Timeline for d3s7oa2: