Lineage for d1ztua1 (1ztu A:137-325)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.1: GAF domain [55782] (8 proteins) 
Protein Bacteriophytochrome BphP [160661] (3 species) 
Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries)
Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325
Domain d1ztua1: 1ztu A:137-325 [146024]
Other proteins in same PDB: d1ztua2
complexed with bla
Details for d1ztua1
PDB Entry: 1ztu (more details), 2.5 Å
PDB Description: structure of the chromophore binding domain of bacterial phytochrome
PDB Compounds: (A:) BacteriophytochromeSCOPe Domain Sequences for d1ztua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztua1 d.110.2.1 (A:137-325) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
phalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh
aflghrfpasdipaqaralytrhllrltadtraaavpldpvlntqtnaptplggavlrat
spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrllslqv
qvkeahhhh
SCOPe Domain Coordinates for d1ztua1:
Click to download the PDB-style file with coordinates for d1ztua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ztua1:
- d1ztua1 first appeared in SCOP 1.75
- d1ztua1 appears in SCOPe 2.04
- d1ztua1 appears in SCOPe 2.06
- d1ztua1 appears in the current release, SCOPe 2.08
View in 3D
