SCOPe 2.06: Domain d3s7oa2: 3s7o A:135-321

Lineage for d3s7oa2 (3s7o A:135-321)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Bacteriophytochrome BphP [160661] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries)
   Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325

8. Domain d3s7oa2: 3s7o A:135-321 [216231]
   Other proteins in same PDB: d3s7oa1, d3s7oa3
   automated match to d1ztua1
   complexed with gol, lbv

Details for d3s7oa2

PDB Entry: 3s7o, 1.24 Å

PDB Description: Crystal Structure of the Infrared Fluorescent D207H variant of Deinococcus Bacteriophytochrome chromophore binding domain at 1.24 angstrom resolution

PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3s7oa2:

Sequence; same for both SEQRES and ATOM records:

>d3s7oa2 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkea

Timeline for d3s7oa2:

• d3s7oa2 first appeared in SCOPe 2.03
  
• d3s7oa2 appears in SCOPe 2.05
  
• d3s7oa2 appears in SCOPe 2.07
  
• d3s7oa2 appears in the current release, SCOPe 2.08