| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
| Domain d1aqdd1: 1aqd D:82-179 [21587] Other proteins in same PDB: d1aqda2, d1aqdb1, d1aqdb2, d1aqdd2, d1aqde1, d1aqde2, d1aqdg2, d1aqdh1, d1aqdh2, d1aqdj2, d1aqdk1, d1aqdk2 |
PDB Entry: 1aqd (more details), 2.45 Å
SCOPe Domain Sequences for d1aqdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqdd1 b.1.1.2 (D:82-179) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwe
Timeline for d1aqdd1: