Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
Domain d1aqda2: 1aqd A:3-81 [38159] Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdb2, d1aqdd1, d1aqde1, d1aqde2, d1aqdg1, d1aqdh1, d1aqdh2, d1aqdj1, d1aqdk1, d1aqdk2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1aqd (more details), 2.45 Å
SCOPe Domain Sequences for d1aqda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqda2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1aqda2: