![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
![]() | Protein automated matches [190961] (22 species) not a true protein |
![]() | Species Mycobacterium abscessus [TaxId:561007] [226092] (1 PDB entry) |
![]() | Domain d3quvb1: 3quv B:1-231 [215429] Other proteins in same PDB: d3quva2, d3quvb2 automated match to d1oy5a_ complexed with edo |
PDB Entry: 3quv (more details), 1.7 Å
SCOPe Domain Sequences for d3quvb1:
Sequence, based on SEQRES records: (download)
>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]} mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmaslle gpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds
>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]} mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaasllegpsytrpps wrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds
Timeline for d3quvb1: