Lineage for d3quvb1 (3quv B:1-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921597Species Mycobacterium abscessus [TaxId:561007] [226092] (1 PDB entry)
  8. 2921599Domain d3quvb1: 3quv B:1-231 [215429]
    Other proteins in same PDB: d3quva2, d3quvb2
    automated match to d1oy5a_
    complexed with edo

Details for d3quvb1

PDB Entry: 3quv (more details), 1.7 Å

PDB Description: crystal structure of a trna-guanine-n1-methyltransferase from mycobacterium abscessus
PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d3quvb1:

Sequence, based on SEQRES records: (download)

>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaqedshsegmaslle
gpsytrppswrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds

Sequence, based on observed residues (ATOM records): (download)

>d3quvb1 c.116.1.0 (B:1-231) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mkidvvtifpeylqpvrqslpgkaidaglvdvavhdlrrwthdvhksvddspygggpgmv
mkptvwgdaldeictsetllvvptpagypftqetawqwstedhlviacgryegidqrvad
daatrmrvrevsigdyvlnggeaaalviieavlrlvpgvlgnalsaasllegpsytrpps
wrgmdvppvllsgdhakiaawraeqsrqrtierrpdllgfds

SCOPe Domain Coordinates for d3quvb1:

Click to download the PDB-style file with coordinates for d3quvb1.
(The format of our PDB-style files is described here.)

Timeline for d3quvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3quvb2