Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (12 species) not a true protein |
Species Plasmodium falciparum [TaxId:137071] [226143] (1 PDB entry) |
Domain d3q2ba_: 3q2b A: [215038] automated match to d1f7sa_ complexed with bme, tar |
PDB Entry: 3q2b (more details), 1.6 Å
SCOPe Domain Sequences for d3q2ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q2ba_ d.109.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 137071]} isgirvndncvtefnnmkirktcgwiifviqnceiiihskgasttltelvqsidknneiq cayvvfdavskihffmyaressnsrdrmtyasskqailkkiegvnvltsviesaqdvadl
Timeline for d3q2ba_: