Lineage for d1f7sa_ (1f7s A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210305Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2210318Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 2210331Species Thale cress (Arabidopsis thaliana), ADF1 [TaxId:3702] [55764] (1 PDB entry)
  8. 2210332Domain d1f7sa_: 1f7s A: [40857]
    complexed with lda

Details for d1f7sa_

PDB Entry: 1f7s (more details), 2 Å

PDB Description: crystal structure of adf1 from arabidopsis thaliana
PDB Compounds: (A:) actin depolymerizing factor (adf)

SCOPe Domain Sequences for d1f7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7sa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Thale cress (Arabidopsis thaliana), ADF1 [TaxId: 3702]}
asgmavhddcklrflelkakrthrfivykieekqkqvvvekvgqpiqtyeefaaclpade
cryaiydfdfvtaencqkskiffiawcpdiakvrskmiyasskdrfkreldgiqvelqat
dpte

SCOPe Domain Coordinates for d1f7sa_:

Click to download the PDB-style file with coordinates for d1f7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7sa_: