Lineage for d1f7sa_ (1f7s A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) 
Family d.109.1.2: Cofilin-like [55762] (2 proteins) Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species) Species Plant (Arabidopsis thaliana), ADF1 [TaxId:3702] [55764] (1 PDB entry) 
Domain d1f7sa_: 1f7s A: [40857]
Details for d1f7sa_
PDB Entry: 1f7s (more details), 2 Å
PDB Description: crystal structure of adf1 from arabidopsis thaliana
SCOP Domain Sequences for d1f7sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7sa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Plant (Arabidopsis thaliana), ADF1}
asgmavhddcklrflelkakrthrfivykieekqkqvvvekvgqpiqtyeefaaclpade
cryaiydfdfvtaencqkskiffiawcpdiakvrskmiyasskdrfkreldgiqvelqat
dpte
SCOP Domain Coordinates for d1f7sa_:
Click to download the PDB-style file with coordinates for d1f7sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f7sa_:
- d1f7sa_ appears in SCOP 1.57
- d1f7sa_ appears in the current release, SCOPe 2.08
View in 3D