![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d1mcoh4: 1mco H:328-428 [21471] Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcol1, d1mcol2 part of intact antibody MCG |
PDB Entry: 1mco (more details), 3.2 Å
SCOPe Domain Sequences for d1mcoh4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcoh4 b.1.1.2 (H:328-428) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1mcoh4: