PDB entry 1mco

View 1mco on RCSB PDB site
Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-02-25, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1 mcg intact antibody (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAB21181 (2-427)
      • conflict (12)
      • conflict (15-16)
      • insertion (26)
      • conflict (27-29)
      • insertion (31)
      • conflict (32-33)
      • conflict (35-36)
      • conflict (38)
      • conflict (44)
      • conflict (51)
      • conflict (53-55)
      • conflict (57)
      • insertion (60)
      • conflict (64)
      • conflict (66)
      • conflict (70-71)
      • conflict (73)
      • conflict (80-82)
      • conflict (99-104)
      • conflict (110)
      • conflict (151)
      • conflict (213)
      • conflict (256)
      • conflict (267)
      • conflict (278)
      • conflict (296)
      • conflict (299)
      • conflict (340)
      • conflict (342)
    Domains in SCOPe 2.07: d1mcoh1, d1mcoh2, d1mcoh3, d1mcoh4
  • Chain 'L':
    Compound: igg1 mcg intact antibody (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR S14675 (1-215)
      • conflict (19)
      • conflict (22)
      • conflict (28)
      • conflict (30)
      • conflict (38)
      • conflict (41)
      • conflict (47-48)
      • conflict (53)
      • conflict (61)
      • conflict (93)
      • conflict (96-99)
      • conflict (102)
      • conflict (105-106)
      • conflict (115)
      • conflict (117)
      • conflict (135)
      • conflict (155)
      • conflict (166)
    Domains in SCOPe 2.07: d1mcol1, d1mcol2
  • Heterogens: NAG, FUL, BMA, MAN, GAL, SIA, GUP

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcoH (H:)
    plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty
    gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkrvapellggpsvflfppkpkdtlmisr
    tpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqynstyrvvsvltvlhqnwld
    gkeykckvsnkalpapiektiskakgqprepqvytlppsreemtknqvsltclvkgfyps
    diavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnh
    ytqkslsl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcoL (L:)
    psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatevclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs