Lineage for d1mcoh3 (1mco H:220-327)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2351136Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2351137Species Human (Homo sapiens) [TaxId:9606] [88585] (58 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2351249Domain d1mcoh3: 1mco H:220-327 [21470]
    Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh4, d1mcol1, d1mcol2
    part of intact antibody MCG
    complexed with bma, ful, gal, gup, man, nag, sia

Details for d1mcoh3

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOPe Domain Sequences for d1mcoh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh3 b.1.1.2 (H:220-327) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq

SCOPe Domain Coordinates for d1mcoh3:

Click to download the PDB-style file with coordinates for d1mcoh3.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh3: