| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() automatically mapped to Pfam PF00600 |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein automated matches [190936] (6 species) not a true protein |
| Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries) |
| Domain d3o9ta_: 3o9t A: [214257] automated match to d3kwgb_ complexed with p6g |
PDB Entry: 3o9t (more details), 2.2 Å
SCOPe Domain Sequences for d3o9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9ta_ d.299.1.1 (A:) automated matches {Influenza A virus [TaxId: 381517]}
sryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletlil
lrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfaw
Timeline for d3o9ta_: