Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) automatically mapped to Pfam PF00600 |
Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
Protein automated matches [190936] (6 species) not a true protein |
Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries) |
Domain d3kwgb_: 3kwg B: [179751] automated match to d2gx9a1 mutant |
PDB Entry: 3kwg (more details), 2.21 Å
SCOPe Domain Sequences for d3kwgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwgb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]} vddddkmtmastpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlka nfsvifdrletlillrafteegaivgeisplpsfpghtiedvknaigvliggleandntv rvsktlqrfawgs
Timeline for d3kwgb_: