Lineage for d3kwgb_ (3kwg B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) 
automatically mapped to Pfam PF00600Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
C-terminal part of Pfam PF00600Protein automated matches [190936] (6 species)
not a true proteinSpecies Influenza A virus [TaxId:381517] [189222] (10 PDB entries) 
Domain d3kwgb_: 3kwg B: [179751]
automated match to d2gx9a1
mutant
Details for d3kwgb_
PDB Entry: 3kwg (more details), 2.21 Å
PDB Description: x-ray structure of ns1 effector domain w187a mutant
PDB Compounds: (B:) Non-structural protein 1SCOPe Domain Sequences for d3kwgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwgb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]}
vddddkmtmastpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlka
nfsvifdrletlillrafteegaivgeisplpsfpghtiedvknaigvliggleandntv
rvsktlqrfawgs
SCOPe Domain Coordinates for d3kwgb_:
Click to download the PDB-style file with coordinates for d3kwgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3kwgb_:
- d3kwgb_ first appeared in SCOPe 2.01
- d3kwgb_ appears in SCOPe 2.03
- d3kwgb_ appears in SCOPe 2.05
- d3kwgb_ appears in the current release, SCOPe 2.08, called d3kwgb1
View in 3D
