Lineage for d3kwgb_ (3kwg B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947558Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1947559Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1947560Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1947565Protein automated matches [190936] (6 species)
    not a true protein
  7. 1947576Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries)
  8. 1947583Domain d3kwgb_: 3kwg B: [179751]
    automated match to d2gx9a1
    mutant

Details for d3kwgb_

PDB Entry: 3kwg (more details), 2.21 Å

PDB Description: x-ray structure of ns1 effector domain w187a mutant
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3kwgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kwgb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]}
vddddkmtmastpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlka
nfsvifdrletlillrafteegaivgeisplpsfpghtiedvknaigvliggleandntv
rvsktlqrfawgs

SCOPe Domain Coordinates for d3kwgb_:

Click to download the PDB-style file with coordinates for d3kwgb_.
(The format of our PDB-style files is described here.)

Timeline for d3kwgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3kwga_