Lineage for d3o9qb_ (3o9q B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688640Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1688641Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1688642Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1688647Protein automated matches [190936] (6 species)
    not a true protein
  7. 1688658Species Influenza A virus [TaxId:381517] [189222] (10 PDB entries)
  8. 1688673Domain d3o9qb_: 3o9q B: [214252]
    automated match to d3kwgb_
    mutant

Details for d3o9qb_

PDB Entry: 3o9q (more details), 2.5 Å

PDB Description: Effector domain of NS1 from A/PR/8/34 containing a W187A mutation
PDB Compounds: (B:) nonstructural protein 1

SCOPe Domain Sequences for d3o9qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9qb_ d.299.1.1 (B:) automated matches {Influenza A virus [TaxId: 381517]}
asryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvliggleandntvrvsetlqrfawrs
s

SCOPe Domain Coordinates for d3o9qb_:

Click to download the PDB-style file with coordinates for d3o9qb_.
(The format of our PDB-style files is described here.)

Timeline for d3o9qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3o9qa_