Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (13 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [226106] (1 PDB entry) |
Domain d3o8ji_: 3o8j I: [214238] automated match to d2ifcc_ complexed with gol |
PDB Entry: 3o8j (more details), 2.41 Å
SCOPe Domain Sequences for d3o8ji_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o8ji_ a.103.1.0 (I:) automated matches {Salmonella enterica [TaxId: 90371]} gntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklkalr glpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslssil lywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnastf tsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrvenke vvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwf savsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsidd rc
Timeline for d3o8ji_: