Lineage for d3o8ji_ (3o8j I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2723061Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2723062Protein automated matches [190763] (13 species)
    not a true protein
  7. 2723120Species Salmonella enterica [TaxId:90371] [226106] (1 PDB entry)
  8. 2723129Domain d3o8ji_: 3o8j I: [214238]
    automated match to d2ifcc_
    complexed with gol

Details for d3o8ji_

PDB Entry: 3o8j (more details), 2.41 Å

PDB Description: Crystal structure of 2-methylcitrate synthase (PrpC) from Salmonella typhimurium
PDB Compounds: (I:) 2-methylcitrate synthase

SCOPe Domain Sequences for d3o8ji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8ji_ a.103.1.0 (I:) automated matches {Salmonella enterica [TaxId: 90371]}
gntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklkalr
glpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslssil
lywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnastf
tsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrvenke
vvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnldwf
savsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsidd
rc

SCOPe Domain Coordinates for d3o8ji_:

Click to download the PDB-style file with coordinates for d3o8ji_.
(The format of our PDB-style files is described here.)

Timeline for d3o8ji_: