![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
![]() | Protein automated matches [190763] (13 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:90371] [226106] (1 PDB entry) |
![]() | Domain d3o8je_: 3o8j E: [214234] automated match to d2ifcc_ complexed with gol |
PDB Entry: 3o8j (more details), 2.41 Å
SCOPe Domain Sequences for d3o8je_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o8je_ a.103.1.0 (E:) automated matches {Salmonella enterica [TaxId: 90371]} pagntalctvgksgndlhyrgydildlaehcefeevahllihgklptrdelnayksklka lrglpanvrtvlealpaashpmdvmrtgvsalgctlpekeghtvsgardiadkllaslss illywyhyshngeriqpetdddsigghflhllhgekptqswekamhislvlyaehefnas tftsrviagtgsdvysaiigaigalrgpkhgganevsleiqqryetpdeaeadirkrven kevvigfghpvytiadprhqvikrvakqlseeggslkmyhiadrletvmwetkkmfpnld wfsavsynmmgvptemftplfviarvtgwaahiieqrqdnkiirpsanytgpedrpfvsi ddrc
Timeline for d3o8je_: