|  | Class a: All alpha proteins [46456] (290 folds) | 
|  | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened | 
|  | Superfamily a.3.1: Cytochrome c [46626] (9 families)  covalently-bound heme completes the core | 
|  | Family a.3.1.0: automated matches [191374] (1 protein) not a true family | 
|  | Protein automated matches [190453] (26 species) not a true protein | 
|  | Species Shewanella oneidensis [TaxId:70863] [226180] (1 PDB entry) | 
|  | Domain d3o5cc2: 3o5c C:172-328 [214177] automated match to d1iqca2 complexed with bu3, ca, hem | 
PDB Entry: 3o5c (more details), 1.8 Å
SCOPe Domain Sequences for d3o5cc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5cc2 a.3.1.0 (C:172-328) automated matches {Shewanella oneidensis [TaxId: 70863]}
tpnspfdqyllgkqdaisgdakagyqlfkdkgcvschngpavggtmfmkmglikpfhtnn
paegrkgvtgkdadkfvfkvptlrnieltypyfhdgsvwtleeavntmadiqlgqkltek
etkemvaflnsltgeqpqislpilppsnketprpvpf
Timeline for d3o5cc2: