![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:70863] [226180] (1 PDB entry) |
![]() | Domain d3o5ca2: 3o5c A:172-331 [214173] automated match to d1iqca2 complexed with bu3, ca, hem |
PDB Entry: 3o5c (more details), 1.8 Å
SCOPe Domain Sequences for d3o5ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5ca2 a.3.1.0 (A:172-331) automated matches {Shewanella oneidensis [TaxId: 70863]} tpnspfdqyllgkqdaisgdakagyqlfkdkgcvschngpavggtmfmkmglikpfhtnn paegrkgvtgkdadkfvfkvptlrnieltypyfhdgsvwtleeavntmadiqlgqkltek etkemvaflnsltgeqpqislpilppsnketprpvpfatg
Timeline for d3o5ca2: