SCOPe 2.07: Domain d3o5cc2: 3o5c C:172-328

Lineage for d3o5cc2 (3o5c C:172-328)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (25 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [226180] (1 PDB entry)

8. Domain d3o5cc2: 3o5c C:172-328 [214177]
   automated match to d1iqca2
   complexed with bu3, ca, hem

Details for d3o5cc2

PDB Entry: 3o5c, 1.8 Å

PDB Description: Cytochrome c Peroxidase BccP of Shewanella oneidensis

PDB Compounds: (C:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3o5cc2:

Sequence; same for both SEQRES and ATOM records:

>d3o5cc2 a.3.1.0 (C:172-328) automated matches {Shewanella oneidensis [TaxId: 70863]}
tpnspfdqyllgkqdaisgdakagyqlfkdkgcvschngpavggtmfmkmglikpfhtnn
paegrkgvtgkdadkfvfkvptlrnieltypyfhdgsvwtleeavntmadiqlgqkltek
etkemvaflnsltgeqpqislpilppsnketprpvpf

Timeline for d3o5cc2:

• d3o5cc2 first appeared in SCOPe 2.03
  
• d3o5cc2 appears in SCOPe 2.06
  
• d3o5cc2 appears in the current release, SCOPe 2.08