| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (19 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries) |
| Domain d3nv0b_: 3nv0 B: [214058] automated match to d1jkga_ protein/RNA complex; complexed with bme, edo, na, peg; mutant |
PDB Entry: 3nv0 (more details), 1.84 Å
SCOPe Domain Sequences for d3nv0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nv0b_ d.17.4.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smkttqeinkedeelcneskkfmdvyydvmdrkrekigflytqvsnavwngnpingydsi
cefmkalpstqhdiqsldaqrlpegvtgdmsggmllnvagavtvdgdskraftqtlllgv
edgkykvksdrfryvd
Timeline for d3nv0b_: