Lineage for d3nv0b_ (3nv0 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405803Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries)
  8. 1405804Domain d3nv0b_: 3nv0 B: [214058]
    automated match to d1jkga_
    protein/RNA complex; complexed with bme, edo, na, peg; mutant

Details for d3nv0b_

PDB Entry: 3nv0 (more details), 1.84 Å

PDB Description: Crystal structure and mutational analysis of the NXF2/NXT1 heterodimeric complex from caenorhabditis elegans at 1.84 A resolution
PDB Compounds: (B:) NTF2-related export protein

SCOPe Domain Sequences for d3nv0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nv0b_ d.17.4.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smkttqeinkedeelcneskkfmdvyydvmdrkrekigflytqvsnavwngnpingydsi
cefmkalpstqhdiqsldaqrlpegvtgdmsggmllnvagavtvdgdskraftqtlllgv
edgkykvksdrfryvd

SCOPe Domain Coordinates for d3nv0b_:

Click to download the PDB-style file with coordinates for d3nv0b_.
(The format of our PDB-style files is described here.)

Timeline for d3nv0b_: