SCOPe 2.05: Domain d3nv0b_: 3nv0 B:

Lineage for d3nv0b_ (3nv0 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (21 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries)

8. Domain d3nv0b_: 3nv0 B: [214058]
   automated match to d1jkga_
   protein/RNA complex; complexed with bme, edo, na, peg; mutant

Details for d3nv0b_

PDB Entry: 3nv0, 1.84 Å

PDB Description: Crystal structure and mutational analysis of the NXF2/NXT1 heterodimeric complex from caenorhabditis elegans at 1.84 A resolution

PDB Compounds: (B:) NTF2-related export protein

SCOPe Domain Sequences for d3nv0b_:

Sequence; same for both SEQRES and ATOM records:

>d3nv0b_ d.17.4.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smkttqeinkedeelcneskkfmdvyydvmdrkrekigflytqvsnavwngnpingydsi
cefmkalpstqhdiqsldaqrlpegvtgdmsggmllnvagavtvdgdskraftqtlllgv
edgkykvksdrfryvd

Timeline for d3nv0b_:

• d3nv0b_ first appeared in SCOPe 2.03
  
• d3nv0b_ appears in SCOPe 2.04
  
• d3nv0b_ appears in SCOPe 2.06
  
• d3nv0b_ appears in the current release, SCOPe 2.08