Lineage for d3ntua1 (3ntu A:4-63)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493702Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493703Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 1493704Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 1493724Species Methanococcus voltae [TaxId:523842] [226806] (1 PDB entry)
  8. 1493725Domain d3ntua1: 3ntu A:4-63 [214055]
    Other proteins in same PDB: d3ntua2
    automated match to d1pzna1
    complexed with anp, mg, na; mutant

Details for d3ntua1

PDB Entry: 3ntu (more details), 1.9 Å

PDB Description: rada recombinase d302k mutant in complex with amp-pnp
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3ntua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntua1 a.60.4.1 (A:4-63) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 523842]}
gltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg

SCOPe Domain Coordinates for d3ntua1:

Click to download the PDB-style file with coordinates for d3ntua1.
(The format of our PDB-style files is described here.)

Timeline for d3ntua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ntua2