Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) contains one classic and one pseudo HhH motifs |
Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
Species Methanococcus voltae [TaxId:523842] [226806] (1 PDB entry) |
Domain d3ntua1: 3ntu A:4-63 [214055] Other proteins in same PDB: d3ntua2 automated match to d1pzna1 complexed with anp, mg, na; mutant |
PDB Entry: 3ntu (more details), 1.9 Å
SCOPe Domain Sequences for d3ntua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ntua1 a.60.4.1 (A:4-63) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 523842]} gltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg
Timeline for d3ntua1: