SCOPe 2.03: Domain d3ntua1: 3ntu A:4-63

Lineage for d3ntua1 (3ntu A:4-63)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Methanococcus voltae [TaxId:523842] [226806] (1 PDB entry)

8. Domain d3ntua1: 3ntu A:4-63 [214055]
   Other proteins in same PDB: d3ntua2
   automated match to d1pzna1
   complexed with anp, mg, na; mutant

Details for d3ntua1

PDB Entry: 3ntu, 1.9 Å

PDB Description: rada recombinase d302k mutant in complex with amp-pnp

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3ntua1:

Sequence; same for both SEQRES and ATOM records:

>d3ntua1 a.60.4.1 (A:4-63) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 523842]}
gltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlg

Timeline for d3ntua1:

• d3ntua1 is new in SCOPe 2.03-stable
  
• d3ntua1 appears in SCOPe 2.04
  
• d3ntua1 appears in the current release, SCOPe 2.08