Lineage for d3my0m1 (3my0 M:195-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)
  8. 2984447Domain d3my0m1: 3my0 M:195-494 [213636]
    Other proteins in same PDB: d3my0a2, d3my0c2, d3my0d2, d3my0e2, d3my0f2, d3my0g2, d3my0h2, d3my0i2, d3my0l2, d3my0m2, d3my0n2, d3my0o2, d3my0q2, d3my0r2, d3my0s2, d3my0t2, d3my0u2, d3my0v2, d3my0w2
    automated match to d2wota_
    complexed with ldn

Details for d3my0m1

PDB Entry: 3my0 (more details), 2.65 Å

PDB Description: crystal structure of the acvrl1 (alk1) kinase domain bound to ldn- 193189
PDB Compounds: (M:) Serine/threonine-protein kinase receptor R3

SCOPe Domain Sequences for d3my0m1:

Sequence, based on SEQRES records: (download)

>d3my0m1 d.144.1.7 (M:195-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlh
veifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkr
ymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndps
fedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn

Sequence, based on observed residues (ATOM records): (download)

>d3my0m1 d.144.1.7 (M:195-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmtsrtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhvei
fgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkryma
pevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfed
mkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn

SCOPe Domain Coordinates for d3my0m1:

Click to download the PDB-style file with coordinates for d3my0m1.
(The format of our PDB-style files is described here.)

Timeline for d3my0m1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3my0m2