Lineage for d3my0b_ (3my0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (764 PDB entries)
  8. 2545987Domain d3my0b_: 3my0 B: [213625]
    Other proteins in same PDB: d3my0a2, d3my0c2, d3my0d2, d3my0e2, d3my0f2, d3my0g2, d3my0h2, d3my0i2, d3my0l2, d3my0m2, d3my0n2, d3my0o2, d3my0q2, d3my0r2, d3my0s2, d3my0t2, d3my0u2, d3my0v2, d3my0w2
    automated match to d2wota_
    complexed with ldn

Details for d3my0b_

PDB Entry: 3my0 (more details), 2.65 Å

PDB Description: crystal structure of the acvrl1 (alk1) kinase domain bound to ldn- 193189
PDB Compounds: (B:) Serine/threonine-protein kinase receptor R3

SCOPe Domain Sequences for d3my0b_:

Sequence, based on SEQRES records: (download)

>d3my0b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlh
veifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkr
ymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndps
fedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn

Sequence, based on observed residues (ATOM records): (download)

>d3my0b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmttqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifg
tqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymape
vldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmk
kvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkisn

SCOPe Domain Coordinates for d3my0b_:

Click to download the PDB-style file with coordinates for d3my0b_.
(The format of our PDB-style files is described here.)

Timeline for d3my0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3my0a1, d3my0a2, d3my0c1, d3my0c2, d3my0d1, d3my0d2, d3my0e1, d3my0e2, d3my0f1, d3my0f2, d3my0g1, d3my0g2, d3my0h1, d3my0h2, d3my0i1, d3my0i2, d3my0j_, d3my0k_, d3my0l1, d3my0l2, d3my0m1, d3my0m2, d3my0n1, d3my0n2, d3my0o1, d3my0o2, d3my0p_, d3my0q1, d3my0q2, d3my0r1, d3my0r2, d3my0s1, d3my0s2, d3my0t1, d3my0t2, d3my0u1, d3my0u2, d3my0v1, d3my0v2, d3my0w1, d3my0w2, d3my0x_