![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
![]() | Domain d3my0n1: 3my0 N:195-493 [213637] Other proteins in same PDB: d3my0a2, d3my0c2, d3my0d2, d3my0e2, d3my0f2, d3my0g2, d3my0h2, d3my0i2, d3my0l2, d3my0m2, d3my0n2, d3my0o2, d3my0q2, d3my0r2, d3my0s2, d3my0t2, d3my0u2, d3my0v2, d3my0w2 automated match to d2wota_ complexed with ldn |
PDB Entry: 3my0 (more details), 2.65 Å
SCOPe Domain Sequences for d3my0n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3my0n1 d.144.1.7 (N:195-493) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd nilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlh veifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkr ymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndps fedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis
Timeline for d3my0n1:
![]() Domains from other chains: (mouse over for more information) d3my0a1, d3my0a2, d3my0b_, d3my0c1, d3my0c2, d3my0d1, d3my0d2, d3my0e1, d3my0e2, d3my0f1, d3my0f2, d3my0g1, d3my0g2, d3my0h1, d3my0h2, d3my0i1, d3my0i2, d3my0j_, d3my0k_, d3my0l1, d3my0l2, d3my0m1, d3my0m2, d3my0o1, d3my0o2, d3my0p_, d3my0q1, d3my0q2, d3my0r1, d3my0r2, d3my0s1, d3my0s2, d3my0t1, d3my0t2, d3my0u1, d3my0u2, d3my0v1, d3my0v2, d3my0w1, d3my0w2, d3my0x_ |