SCOPe 2.08: Domain d3my0e1: 3my0 E:195-493

Lineage for d3my0e1 (3my0 E:195-493)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3my0e1: 3my0 E:195-493 [213628]
   Other proteins in same PDB: d3my0a2, d3my0c2, d3my0d2, d3my0e2, d3my0f2, d3my0g2, d3my0h2, d3my0i2, d3my0l2, d3my0m2, d3my0n2, d3my0o2, d3my0q2, d3my0r2, d3my0s2, d3my0t2, d3my0u2, d3my0v2, d3my0w2
   automated match to d2wota_
   complexed with ldn

Details for d3my0e1

PDB Entry: 3my0, 2.65 Å

PDB Description: crystal structure of the acvrl1 (alk1) kinase domain bound to ldn- 193189

PDB Compounds: (E:) Serine/threonine-protein kinase receptor R3

SCOPe Domain Sequences for d3my0e1:

Sequence, based on SEQRES records:

>d3my0e1 d.144.1.7 (E:195-493) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahlh
veifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkr
ymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndps
fedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis

Sequence, based on observed residues (ATOM records):

>d3my0e1 d.144.1.7 (E:195-493) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrhd
nilgfiasdmtqlwlithyhehgslydflqrqtlephlalrlavsaacglahlhveifgt
qgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtkrymapev
ldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndpsfedmkk
vvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis

Timeline for d3my0e1:

• d3my0e1 first appeared in SCOPe 2.03, called d3my0e_
  
• d3my0e1 appears in SCOPe 2.07