Lineage for d3mn5a2 (3mn5 A:147-374)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857787Protein automated matches [226905] (12 species)
    not a true protein
  7. 1857890Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)
  8. 1857892Domain d3mn5a2: 3mn5 A:147-374 [213478]
    Other proteins in same PDB: d3mn5a1
    automated match to d1d4xa2
    complexed with atp, ca, lab

Details for d3mn5a2

PDB Entry: 3mn5 (more details), 1.5 Å

PDB Description: structures of actin-bound wh2 domains of spire and the implication for filament nucleation
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3mn5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mn5a2 c.55.1.1 (A:147-374) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOPe Domain Coordinates for d3mn5a2:

Click to download the PDB-style file with coordinates for d3mn5a2.
(The format of our PDB-style files is described here.)

Timeline for d3mn5a2: