![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (7 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [64086] (1 PDB entry) |
![]() | Domain d1d4xa2: 1d4x A:147-375 [59108] Other proteins in same PDB: d1d4xg_ complexed with atp, ca, mg, so2, so4 |
PDB Entry: 1d4x (more details), 1.75 Å
SCOPe Domain Sequences for d1d4xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4xa2 c.55.1.1 (A:147-375) Actin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} rttgvvldsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer eivrdikeklcyvaldfeqemataassssleksyelpdgqvitvgnerfrcpeamfqpsf lgmesagihetsynsimkcdidirkdlyantvlsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d1d4xa2: