SCOPe 2.04: Domain d3mn5a2: 3mn5 A:147-374

Lineage for d3mn5a2 (3mn5 A:147-374)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (11 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)

8. Domain d3mn5a2: 3mn5 A:147-374 [213478]
   Other proteins in same PDB: d3mn5a1
   automated match to d1d4xa2
   complexed with atp, ca, lab

Details for d3mn5a2

PDB Entry: 3mn5, 1.5 Å

PDB Description: structures of actin-bound wh2 domains of spire and the implication for filament nucleation

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3mn5a2:

Sequence; same for both SEQRES and ATOM records:

>d3mn5a2 c.55.1.1 (A:147-374) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d3mn5a2:

• d3mn5a2 first appeared in SCOPe 2.03
  
• d3mn5a2 appears in SCOPe 2.05
  
• d3mn5a2 appears in the current release, SCOPe 2.08