Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) duplication: contains two domains of this fold |
Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries) Uniprot Q59110 123-196,262-366 |
Domain d3mmae2: 3mma E:123-196,E:262-366 [213436] Other proteins in same PDB: d3mmaa1, d3mmaa2, d3mmaa3, d3mmab1, d3mmab3, d3mmad1, d3mmad2, d3mmad3, d3mmae1, d3mmae3 automated match to d3mmcb3 complexed with po4, sf4, srm |
PDB Entry: 3mma (more details), 2.3 Å
SCOPe Domain Sequences for d3mmae2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmae2 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]} kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw
Timeline for d3mmae2: