Lineage for d3mmae2 (3mma E:123-196,E:262-366)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584195Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2584196Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2584197Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2584219Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)
  7. 2584220Species Archaeoglobus fulgidus [TaxId:2234] [160774] (9 PDB entries)
    Uniprot Q59110 123-196,262-366
  8. 2584236Domain d3mmae2: 3mma E:123-196,E:262-366 [213436]
    Other proteins in same PDB: d3mmaa1, d3mmaa2, d3mmaa3, d3mmab1, d3mmab3, d3mmad1, d3mmad2, d3mmad3, d3mmae1, d3mmae3
    automated match to d3mmcb3
    complexed with po4, sf4, srm

Details for d3mmae2

PDB Entry: 3mma (more details), 2.3 Å

PDB Description: dissimilatory sulfite reductase phosphate complex
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmae2 d.134.1.1 (E:123-196,E:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

SCOPe Domain Coordinates for d3mmae2:

Click to download the PDB-style file with coordinates for d3mmae2.
(The format of our PDB-style files is described here.)

Timeline for d3mmae2: