| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
| Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
| Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [160779] (8 PDB entries) Uniprot Q59109 168-239,306-418 |
| Domain d3mmaa2: 3mma A:167-238,A:305-417 [213427] Other proteins in same PDB: d3mmaa1, d3mmaa3, d3mmab1, d3mmab2, d3mmab3, d3mmad1, d3mmad3, d3mmae1, d3mmae2, d3mmae3 automated match to d3mmca3 complexed with po4, sf4, srm |
PDB Entry: 3mma (more details), 2.3 Å
SCOPe Domain Sequences for d3mmaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mmaa2 d.134.1.1 (A:167-238,A:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw
Timeline for d3mmaa2: