Lineage for d3mmaa1 (3mma A:1-166)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562266Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562308Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2562309Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 2562310Species Archaeoglobus fulgidus [TaxId:2234] [160338] (8 PDB entries)
    Uniprot Q59109 2-418
  8. 2562323Domain d3mmaa1: 3mma A:1-166 [213426]
    Other proteins in same PDB: d3mmaa2, d3mmaa3, d3mmab1, d3mmab2, d3mmab3, d3mmad2, d3mmad3, d3mmae1, d3mmae2, d3mmae3
    automated match to d3mmca2
    complexed with po4, sf4, srm

Details for d3mmaa1

PDB Entry: 3mma (more details), 2.3 Å

PDB Description: dissimilatory sulfite reductase phosphate complex
PDB Compounds: (A:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d3mmaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmaa1 d.58.36.2 (A:1-166) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
setplldelekgpwpsfvkeikktaelmekaaaegkdvkmpkgargllkqleisykdkkt
hwkhggivsvvgygggvigrysdlgeqipevehfhtmrinqpsgwfystkalrglcdvwe
kwgsgltnfhgstgdiiflgtrseylqpcfedlgnleipfdiggsg

SCOPe Domain Coordinates for d3mmaa1:

Click to download the PDB-style file with coordinates for d3mmaa1.
(The format of our PDB-style files is described here.)

Timeline for d3mmaa1: