| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species) Suppressor of kinetochore protein 1,Scskp1 |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries) |
| Domain d3mksc2: 3mks C:116-186 [213313] Other proteins in same PDB: d3mksa1, d3mksb1, d3mksb2, d3mksc1, d3mksd1, d3mksd2 automated match to d1nexc1 complexed with c1c, gol, so4 |
PDB Entry: 3mks (more details), 2.6 Å
SCOPe Domain Sequences for d3mksc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mksc2 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaairr
Timeline for d3mksc2: