Lineage for d3mksa2 (3mks A:116-185)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752264Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1752265Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1752266Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1752267Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 1752268Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries)
  8. 1752269Domain d3mksa2: 3mks A:116-185 [213309]
    Other proteins in same PDB: d3mksa1, d3mksb1, d3mksb2, d3mksc1, d3mksd1, d3mksd2
    automated match to d1nexa1
    complexed with c1c, gol, so4

Details for d3mksa2

PDB Entry: 3mks (more details), 2.6 Å

PDB Description: crystal structure of yeast cdc4/skp1 in complex with an allosteric inhibitor scf-i2
PDB Compounds: (A:) Suppressor of kinetochore protein 1

SCOPe Domain Sequences for d3mksa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mksa2 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaair

SCOPe Domain Coordinates for d3mksa2:

Click to download the PDB-style file with coordinates for d3mksa2.
(The format of our PDB-style files is described here.)

Timeline for d3mksa2: