| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d3mffb1: 3mff B:2-115 [213216] Other proteins in same PDB: d3mffa2, d3mffb2, d3mffc2, d3mffd2 automated match to d1fyte1 complexed with arg, gol, ure |
PDB Entry: 3mff (more details), 2 Å
SCOPe Domain Sequences for d3mffb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mffb1 b.1.1.0 (B:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
kgyrvsrkkrehfslildsaktnqtsvyfcasslagtgnyeqyfgpgtrltvte
Timeline for d3mffb1: