Lineage for d3mffc2 (3mff C:122-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750350Domain d3mffc2: 3mff C:122-210 [213219]
    Other proteins in same PDB: d3mffa1, d3mffb1, d3mffc1, d3mffd1
    automated match to d1qrnd2
    complexed with arg, gol, ure

Details for d3mffc2

PDB Entry: 3mff (more details), 2 Å

PDB Description: 1f1e8hu tcr
PDB Compounds: (C:) T cell receptor alpha chain

SCOPe Domain Sequences for d3mffc2:

Sequence, based on SEQRES records: (download)

>d3mffc2 b.1.1.2 (C:122-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdatvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3mffc2 b.1.1.2 (C:122-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtskdsdvyitdatvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3mffc2:

Click to download the PDB-style file with coordinates for d3mffc2.
(The format of our PDB-style files is described here.)

Timeline for d3mffc2: