SCOPe 2.08: Domain d3mffa1: 3mff A:11-121

Lineage for d3mffa1 (3mff A:11-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3mffa1: 3mff A:11-121 [213214]
   Other proteins in same PDB: d3mffa2, d3mffb2, d3mffc2, d3mffd2
   automated match to d1qrnd1
   complexed with arg, gol, ure

Details for d3mffa1

PDB Entry: 3mff, 2 Å

PDB Description: 1f1e8hu tcr

PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d3mffa1:

Sequence; same for both SEQRES and ATOM records:

>d3mffa1 b.1.1.0 (A:11-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrqspqsltvwegettilncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
tiffnkrekklslhitdsqpgdsatyfcaatgantgkltfghgtilrvhpn

Timeline for d3mffa1:

• d3mffa1 first appeared in SCOPe 2.03
  
• d3mffa1 appears in SCOPe 2.07