PDB entry 3mff

View 3mff on RCSB PDB site
Description: 1F1E8hu TCR
Class: immune system
Keywords: T-cell receptor, Protein metamorphism, Alpha constant domain, IMMUNE SYSTEM
Deposited on 2010-04-02, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MFF (0-199)
    Domains in SCOPe 2.07: d3mffa1, d3mffa2
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MFF (0-241)
    Domains in SCOPe 2.07: d3mffb1, d3mffb2
  • Chain 'C':
    Compound: T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MFF (0-199)
    Domains in SCOPe 2.07: d3mffc1, d3mffc2
  • Chain 'D':
    Compound: T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MFF (0-241)
    Domains in SCOPe 2.07: d3mffd1, d3mffd2
  • Heterogens: GOL, URE, ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mffA (A:)
    qvrqspqsltvwegettilncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgantgkltfghgtilrvhpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdatvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mffA (A:)
    qvrqspqsltvwegettilncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgantgkltfghgtilrvhpniqnpdpavy
    qlrdskssdksvclftdfdskdsdvyitdatvldmrsmdfksnsavawsnksdfacanaf
    nnsiipedtffps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mffB (B:)
    mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
    kgyrvsrkkrehfslildsaktnqtsvyfcasslagtgnyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqp
    alndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mffC (C:)
    qvrqspqsltvwegettilncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgantgkltfghgtilrvhpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdatvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mffC (C:)
    qvrqspqsltvwegettilncsyensafdyfpwyqqfpgegpalliairsvsdkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgantgkltfghgtilrvhpniqnpdpavy
    qlrdskssdksvclftdfdsqtskdsdvyitdatvldmrsmdfksnsavawsnksdfaca
    nafnnsiipedtffps
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mffD (D:)
    mkvtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdip
    kgyrvsrkkrehfslildsaktnqtsvyfcasslagtgnyeqyfgpgtrltvtedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqp
    alndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rs