![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (11 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries) |
![]() | Domain d3m6gb1: 3m6g B:4-146 [213137] automated match to d1lotb1 complexed with atp, ca, lo3, mg |
PDB Entry: 3m6g (more details), 2 Å
SCOPe Domain Sequences for d3m6gb1:
Sequence, based on SEQRES records: (download)
>d3m6gb1 c.55.1.1 (B:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim fetfnvpamyvaiqavlslyasg
>d3m6gb1 c.55.1.1 (B:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ettalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehg iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv aiqavlslyasg
Timeline for d3m6gb1: